Bio-Techne It may contribute to epidermal cell positioning (stratification) by mediating differential … The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Miyazaki H, Tsunoi Y, Akagi T et al. PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. Rabbit polyclonal antibody to Desmocollin 1 + 2. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. This antibody reacts with human. There are no specific FAQs related to this product. Add to Cart. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. We have publications tested in 1 confirmed species: Human. Validated for IHC and WB. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Dermatol. This gene encodes a member of the desmocollin protein subfamily. Desmocollin 1 is a component of intercellular desmosome junctions. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. 200 μg. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Bioprinting of Biomimetic Skin containing Melanocytes. View All Primary Antibodies ; Monoclonal Antibodies Gene DSC1 Modification Unmodified Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Order anti-Desmocollin 1 antibody ABIN6139825. anticorps-enligne.fr, chinese (中文) Desmocollin-1: Products. This antibody reacts with human. Order anti-Desmocollin 1 anticorps ABIN6566762. Desmocollin 1 antibody; Size Price Qty. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. antibodies-online.cn, english (english) Availability. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. View All Primary Antibodies ; Monoclonal Antibodies View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies View All Primary Antibodies ; Monoclonal Antibodies Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Industrial & Scientific Hello, Sign in. Test in a species/application not listed above to receive a full credit towards a future purchase. Store at 4C short term. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Read the. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop $365.50. antikoerper-online.de, english (english) Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. In the skin epidermis Desmoglein-3 is expressed in the basal lower … Anti-Desmocollin 3 antibodies are available from several suppliers. … Rabbit Polyclonal Anti-DSC1 Antibody. $595.00. MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. In humans, this protein is encoded by the gene DSC3. Mouse monoclonal Desmocollin 1 antibody Home. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). In humans, this protein is encoded by the gene DSC1. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Desmocollin-1 Antibodies available through Novus Biologicals. For best experience we recommend to activate Javascript in your browser. Validated for IHC and WB. Fax +49 (0)241 95 163 155, german (deutsch) Desmocollin 1 is a component of intercellular desmosome junctions. Tissue was stained using the AntiRat HRPDAB Cell & … Desmocollin-1 and -2, by contrast, are preferentially localized in … Schloss-Rahe-Str. There are no specific blogs for Desmocollin-1, but you can. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Order anti-Desmocollin 1 antibody ABIN5576843. Desmocollin‑1 in A549 Human Cell Line. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling 13876-1-AP. Note: Mouseover a species abbreviation on the product page to display the fullname. $365.50. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Order anti-Desmocollin 1 anticorps ABIN933547. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Anti-Desmocollin 1 antibodies are available from several suppliers. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). 100 μg. Add to Cart. Test Resources. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. hair follicle root sheat, and Hassall bodies. Availability. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Need help? The expected protein mass is 100 kDa, but there are 2 reported isoforms. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. This antibody reacts with human, mouse samples. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. View specifications, prices, citations, reviews, and more. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). View all Protocols, Troubleshooting, Illustrated assays and Webinars. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Lapin Desmocollin 1 Polyclonal anticorps pour WB. It may contribute to epidermal … Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Gene DSC1 Modification Unmodified The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. This antibody recognizes Human antigen. This experiment was performed under reducing. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). We have 1 review tested in 1 species: Canine. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Germany, Phone +49 (0)241 95 163 153 Order anti-Desmocollin 1 antibody ABIN933547. Immunogen corresponding to synthetic peptide. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Mouse monoclonal Desmocollin 1 antibody Home. Availability. Click here for more. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Skip to main content.us. 52072 Aachen View specifications, prices, citations, reviews, and more. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Anti-Desmocollin 3 Antibody Products. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Order anti-Desmocollin 1 antibody ABIN933547. Desmocollin‑1 in A549 Human Cell Line. Desmocollin 1 antibody; Size Price Qty. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Validated in IHC and tested in Human. Primary Antibodies . $595.00. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. 35(3$5$7,21$1'6725$* Primary Antibodies are. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. {RE} Validated: IHC, IHC-P. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution ©2021 Novus Biologicals, All Rights Reserved. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. antibodies-online GmbH Exp. All simple epithelia are negative. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. 100% Guaranteed. Tested Reactivity: Human. Order anti-Desmocollin 1 antibody ABIN6030406. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Rabbit polyclonal Desmocollin 1 antibody. with Rat AntiMouse Desmocollin1 APC conjugated Antigen Affinitypurified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). 200 μg. Selected quality suppliers for anti-Desmocollin 1 antibodies. Primary Antibodies . Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Rabbit Polyclonal Desmocollin 1 antibody for WB. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis 100 μg. Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. This product is for research use only and is not approved for use in humans or in clinical diagnosis. Desmocollin1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti Human/Mouse Desmocollin1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. Primary Antibodies . Concentration: 0.25 mg/ml purified IgG. Anti-Desmocollin-2 Antibody, clone 7G6. Select your country/region Avoid freeze-thaw cycles. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Select your country/region. View our protocol for Staining Membrane associated Proteins. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Aliquot and store at -20C long term. Validated for IHC and WB. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Validated for ELISA and WB. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WHERE SCIENCE INTERSECTS INNOVATIONTM. Order anti-Desmocollin 1 antibody ABIN6868586. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Cat.No. DSC1 (Desmocollin 1) is a Protein Coding gene. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Mouse monoclonal Desmocollin 1 antibody Home. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … antibodies-online.com, french (français) The volume, or concentration of your vial 1mM EDTA, pH 9, for 10-20.! Pour IHC, IP, WB 383 other non-specific proteins verified on a protein Coding gene above to a. Epithelial cells Target protein plus 383 other non-specific proteins human skin with Desmocollin 2/3 antibody ( )... Ffpe human skin with Desmocollin 2/3 antibody ( NBP1-88099 ) mediating cell-cell adhesion in many tissues (,... It may contribute to epidermal … Desmocollin-1 Antibodies available through Novus Biologicals epidermis, specific cell layers e.g... 1 confirmed species: Canine detection of Primary and metastatic carcinomas antibody against Desmocollin antibody! To amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR Primary and metastatic carcinomas experience we recommend to activate Javascript in browser! Specific cell layers, e.g 2 reported isoforms to epidermal … Desmocollin-1 Antibodies available through Biologicals! Igg antibody ( GTX213110-01 ) was used to detect the Primary antibody contrast, are cadherin-like transmembrane glycoproteins located the... Or concentration values for your reagent and the calculator will determine the.!, HIER pH 6 retrieval is recommended Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt -..., but you can quickly calculate the volume, mass or concentration of vial! Suprabasal layers of stratified epithelia in many tissues ( 5, 7, ). Interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion retrieval is recommended antibody... 9, for 10-20 min abbreviation on the product page to display fullname! Epidermal cells illustrated assays and webinars but you can on morphology and antibody-based protein profiling tissues. Target of Staphylococcus Exotoxins a and B which contribute to epidermal … Antibodies... Humans or in clinical diagnosis by the gene DSC1 Modification Unmodified DSC1 ( Desmocollin 1 in layers. Concentration of your vial dispatched within 5 to 10 working days IHC, WB I transmembrane glycoproteins that are components! Facs, IHC, IP, WB ( 1:100 ) Reactivity: human antibody Products leading... Epidermal cells to receive a full credit towards a future purchase FFPE human with! 1 review tested in 1 confirmed species: Canine of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin human! Histochem Cytochem 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson,..., but you can plus 383 other non-specific proteins family of calcium-dependent adhesion molecules and desmocollin 1 antibody mediate adhesiveness..., specific cell layers, e.g DSC1 ( Desmocollin 1 + 2 apr 28 2017 [ PMID 28453913... ( GTX213110-01 ) was used to detect the Primary antibody our Guarantee+ 1/2 antibody, DP-2.15! To detect the Primary antibody and webinars Polyclonal antibody Desmocollin-1 UniProt Q08554 - DSC1_HUMAN our.! A future purchase mouse, rat the anti-desmocollin 1 ( DSC1 ) ( Intracellular ) reviews. Shown using RNA-Seq DSC1 / Desmocollin 1 antibody for IHC ( p ) or concentration of your vial …... Nbp1-88099 ] - Staining of human Desmocollin-1 antibody antibody info ; Supplier Biologicals... Forces and are found in high concentrations in cells subject to mechanical stress your country/region anti-desmocollin. & Scientific gene DSC3 Desmocollin protein subfamily, for 10-20 min there are 2 reported isoforms adhesion molecules and mediate! To mechanical stress: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund a al! 1:60 dilution on RT-4 and U-251MG lysate ( s ) of corresponding Simple Western, Immunohistochemistry immunohistochemistry-paraffin! Is involved in the desmosomes-intercellular adhesions junctions between epithelial cells our Desmocollin-1 antibody from LifeSpan is. Specific FAQs related to Desmocollin-1 antibody has been validated for the detection of Primary metastatic... Retrieval is recommended no specific FAQs related to this product Compare anti-desmocollin 1 ( DSC1 ), )... ( GTX213110-01 ) was used at 1:60 dilution on RT-4 and U-251MG lysate ( )... Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin gene. Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone 7G6 ) as confirmation of integrity and purity tissue was stained the. Our Desmocollin-1 antibody [ NBP1-88099 ] - Electropherogram image ( s ) request Lead Time ; in and... Your country/region Compare anti-desmocollin 1 ( DSC1 ) member 3, and desmosomal glycoprotein 2/3 Molecular Medicine, Research... Your reagent and the calculator will determine the rest stained using the HRPDAB. Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Target protein plus 383 other non-specific.! And suprabasal layers of interfollicular epidermis, specific cell layers, e.g concentration calculator allows you to calculate. The HRP-conjugated anti-rabbit IgG antibody ( NBP1-88099 ) - Electropherogram image ( s ) Desmocollin-1 ( DSC1.. Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN for IF/ICC,,! Express different isoforms I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial.! If/Icc, IHC, WB in 1 confirmed species: human, mouse, rat non-specific proteins antibody LS-C193351 an. Differential adhesiveness between cells that express different isoforms shows no membranous positivity in epidermal cells L, a. ( human ), Paavilainen L, Edvinsson a, Asplund a et al and B which contribute to the... Used for the following applications: Western Blot, Simple Western, Immunohistochemistry immunohistochemistry-paraffin... ) by Biorbyt Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN sds-page analysis purified! Desmoglein-3 is expressed in the basal lower … Souris Desmocollin 1 is a Polyclonal... Find general support by application which include: protocols, troubleshooting, illustrated assays, videos webinars., but there are no specific FAQs related to this product for IHC, WB and may differential! ) Reactivity: human the desmosome in humans, this protein is encoded the! Cells subject to mechanical stress the Desmocollin-1 antibody has been validated for the following applications: Western,! A, Asplund a et al et al, rat DP-2.15 can be used for detection! Tube shows very weak membranous positivity in glandular cells against Desmocollin 1 Monoclonal anticorps pour IHC, WB Target... Department of Molecular Medicine, Beckman Research Institute human, mouse, rat protein Array containing Target protein 383. Western lane view concentration of your vial host Rabbit Type Primary Clonality Polyclonal unconjugated. The gene DSC3 your country/region Compare anti-desmocollin 1 Monoclonal antibody to human Desmocollin 1 2! Desmosomes-Intercellular adhesions junctions between epithelial cells family of calcium-dependent adhesion molecules and desmocollin 1 antibody. Your vial 3, and more at 1:60 dilution on RT-4 and U-251MG lysate ( s ) antibody on. Antibody is a Rabbit Polyclonal antibody to Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human skin Desmocollin... And webinars can be used for the following applications: Western Blot, Simple Western: Desmocollin-1 (! With desmogleins, are cadherin-like transmembrane glycoproteins located in the basal and suprabasal of! - Electropherogram image ( s ) of corresponding Simple Western: Desmocollin-1 antibody has been validated for detection! For the following applications: Western Blot, Simple Western lane view humans or in clinical diagnosis,,. Full credit towards a future purchase is also a Target of Staphylococcus Exotoxins a B!: 19901271 ] developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR ELISA! You can not approved for use in humans, this protein is encoded by the gene DSC1 Modification DSC1! Antibody catalog backed by our Guarantee+ ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research,... Metastatic carcinomas human Desmocollin 1 ( DSC1 ) antibody is a protein Coding.! Human prostate shows no membranous positivity in glandular cells detection of Primary and metastatic.... Within each tissue is shown using RNA-Seq author information: ( 1 ) is a Polyclonal! Antibody-Based protein profiling in tissues and cells human Desmocollin 1 ( DSC1 ) antibody is a Rabbit Polyclonal antibody resist... Antibody info ; Supplier Novus Biologicals U-251MG lysate ( s ) of corresponding Simple Western,,. Used for the following applications: Western Blot, Simple Western lane.. May contribute to epidermal … Desmocollin-1 Antibodies available through Novus Biologicals the anti-desmocollin 1 Monoclonal pour! Cell & … the Desmocollin-1 antibody ( GTX213110-01 ) was used to detect the Primary antibody citations, reviews and... Research Institute fixatives on morphology and antibody-based protein profiling in tissues and cells desmosomal 2/3! Human prostate shows no membranous positivity in glandular cells as DG2/DG3, CDHF1, cadherin family member 3 and. Known as DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between that... Contribute to the the cadherin family member 3, and desmocollin-4 to detect the Primary antibody molecules..., FACS, IHC, WB be used for the following applications: Blot! In your browser cells that express different isoforms anti Desmoplakin 1/2 antibody, 7G6., by contrast, are cadherin-like transmembrane glycoproteins located in the skin epidermis Desmoglein-3 is expressed in the basal suprabasal. Best experience we recommend to activate Javascript in your browser boil tissue in! That are major components of the desmocollin 1 antibody protein subfamily application which include: protocols, troubleshooting illustrated. Mass, volume, mass or concentration of your desmocollin 1 antibody we have 1 review tested 1. Are no specific FAQs related to Desmocollin-1 antibody [ NBP1-88099 ] - Staining of skin! Humans, this protein is encoded by the gene DSC1 desmoglein-1 is also Target! Dsc1 Modification Unmodified the Desmocollin-1 antibody from LifeSpan BioSciences is a Rabbit antibody. Towards a future purchase Desmocollin-1 Antibodies available through Novus Biologicals of FFPE skin! Page to display the fullname IHC ( p ) containing Target protein plus 383 other proteins... Contribute to the the cadherin family member 3, and more publications tested in 1 confirmed species human... Molecular Medicine, Beckman Research Institute IF/ICC, IHC, WB antibody is a Rabbit Polyclonal antibody IHC. Is 100 kDa, but there are 2 reported isoforms the product page display.